DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and TMED5

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_057124.3 Gene:TMED5 / 50999 HGNCID:24251 Length:229 Species:Homo sapiens


Alignment Length:195 Identity:56/195 - (28%)
Similarity:89/195 - (45%) Gaps:12/195 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQGKVIYSLEKATFDSHQFVA 85
            :|||.|.....:|||:.:...:|...|:||..|..||:|..|..|:||.:. .|:...|....|.
Human    35 DFTFTLPAGQKECFYQPMPLKASLEIEYQVLDGAGLDIDFHLASPEGKTLV-FEQRKSDGVHTVE 98

  Fly    86 ETTGVYTACFGNQFSAFSHKIVYVDF---QVGEEPA--------LPGVDEHATVLTQMETSSQAI 139
            ...|.|..||.|.||..|.|:::.:.   .:||:..        :.|.|.....|..:..|..:|
Human    99 TEVGDYMFCFDNTFSTISEKVIFFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSI 163

  Fly   140 HKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQIMVLRNFFTDRKPSQ 204
            ...|:.....||..|..||:.|...|....||..||.:....::|:..:|:.:|::.|.|::.|:
Human   164 KSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVVSAIQVYMLKSLFEDKRKSR 228

  Fly   205  204
            Human   229  228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 53/186 (28%)
TMED5NP_057124.3 EMP24_GP25L 35..222 CDD:279450 53/187 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.