DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and tmed9

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001011147.1 Gene:tmed9 / 496564 XenbaseID:XB-GENE-944838 Length:217 Species:Xenopus tropicalis


Alignment Length:208 Identity:58/208 - (27%)
Similarity:96/208 - (46%) Gaps:19/208 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LMMHCIS-AVEFTFDLADNAVDCFYEEIKKNS-------SAYFEFQ----VSAGGQLDVDVTLKD 64
            |:..|.. |....|.:.:....||.|||...:       :..|:.|    :.|...|.:.|.:||
 Frog     9 LLAACFGPAFSLYFHIGETEKKCFIEEIPDETMVVGNYRTQMFDKQREDYLPATPGLGMFVEVKD 73

  Fly    65 PQGKVIYSLEKATFDSHQFVAETTGVYTACF---GNQFSAFSHKI--VYVDFQVGEEPALPGVDE 124
            |..|||.|.:..:.....|.:.|.|.:..|.   ..:|:.|:..:  |::|.||||. |...||.
 Frog    74 PDDKVILSRQYGSEGRFTFTSHTPGEHQICLHSNSTKFALFAGGMLRVHLDIQVGEH-ANDYVDI 137

  Fly   125 HA-TVLTQMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLV 188
            .| ..|..::...:.:.:.:..|...|.:.|.||.:.|:.:|..:|||:.||..:|..::.||:.
 Frog   138 AAKDKLNTLQLRVRQLIEQVEQIQKEQNYQRWREERFRQTSESTSQRVLWWSIAQTLILVTIGVW 202

  Fly   189 QIMVLRNFFTDRK 201
            |:..|:.||..:|
 Frog   203 QMKHLKGFFEAKK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 52/192 (27%)
tmed9NP_001011147.1 EMP24_GP25L 19..212 CDD:366467 53/193 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.