DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and tmed1a

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001003487.1 Gene:tmed1a / 445093 ZFINID:ZDB-GENE-040801-229 Length:226 Species:Danio rerio


Alignment Length:222 Identity:72/222 - (32%)
Similarity:97/222 - (43%) Gaps:28/222 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TQIVVFAVALMMHCISA---------VEFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDV 58
            |::.|..::.:..|:..         .||||.|...|.:||::...||||...|:||.||..|||
Zfish     4 TRLAVCFLSFLTLCLDLGFTFGQNKDTEFTFLLPAGATECFFQTATKNSSMEVEYQVIAGSGLDV 68

  Fly    59 DVTLKDPQGKVIYSLEKATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYV----DFQVGEEPAL 119
            ..||..|:|..:.|..:.:...|...:...|.|..||.|.||..|.|:|||    |...||:.. 
Zfish    69 GFTLISPRGYRLVSDFRKSDGIHTVDSTEEGDYRICFDNSFSRISEKMVYVEVIMDGPEGEDED- 132

  Fly   120 PGVDEHATVLTQMETSSQ-----------AIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMV 173
               ||....|.:.|.|.:           |:||.|......||..|..||:.|...||...||..
Zfish   133 ---DEDWAALAEPEDSLEYKLEDIRDSMDAVHKSLERSRQLQTTLRAFEARDRYLLEDNLWRVSF 194

  Fly   174 WSSLETAAVIVIGLVQIMVLRNFFTDR 200
            ||......:|.:.|.|:..||..|.|:
Zfish   195 WSCASLLVMISVALTQVYTLRRLFNDK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 67/190 (35%)
tmed1aNP_001003487.1 EMP24_GP25L 31..219 CDD:279450 67/191 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585519
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.