DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and bai

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster


Alignment Length:207 Identity:55/207 - (26%)
Similarity:90/207 - (43%) Gaps:22/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FAVALMMHCI-SAVEFTFDLADNAVDCFYEEIKKNSSAYFEFQVS-AGGQLDVDVTLKDPQGKVI 70
            |.|.|:|.|. |:....|.|:.|...|..|:|:.|.....||:|| ..||: :|...:|.:|.::
  Fly     6 FIVCLLMACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDVPGQI-IDYIARDTKGHIL 69

  Fly    71 YSLEKATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYVDFQVG-------EEPALPGVDEHATV 128
            ...|..|.....|::|....|..||.::..|....::.   :|.       |..:..|:.| |:.
  Fly    70 SQKEHITKGKFSFMSEVYDTYEICFISKVPAHQRGVIQ---EVSLLTKKGVETKSYEGIGE-ASK 130

  Fly   129 LTQMETSSQAIHKGLNDILDAQTHH----RLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQ 189
            |..:|...    |.|.|:.|:....    |.||.:.|...|..|.||:.:|......::.:...|
  Fly   131 LKPLEVDL----KRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCLLGLATWQ 191

  Fly   190 IMVLRNFFTDRK 201
            ::.||.:|..:|
  Fly   192 VLYLRRYFKAKK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 47/187 (25%)
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 47/188 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.