DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and loj

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster


Alignment Length:228 Identity:51/228 - (22%)
Similarity:102/228 - (44%) Gaps:32/228 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVFAVALMMHCI--------------------SAVEFTFDLADNAVDCFYEEIKKNSSAYFEFQV 50
            :|..:||:..|:                    .|:::...:.....||:::.:|..::.|..|.|
  Fly    12 LVLPIALICCCLLIDVTSAQEAQQPWYENLPAVAMDYKVHIDAGKEDCYHQYVKAGATFYVSFSV 76

  Fly    51 SAGGQLDVDVTLKDPQGKVIYSLE-KATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYVDFQVG 114
            ..||.......:::|.|:|:...: :||.|....|: ..|.|:.|..||||.|:.|:|.:...|.
  Fly    77 VRGGDGMAGFAVRNPAGEVVKPYQWQATADYTDQVS-PGGYYSVCIDNQFSRFAGKLVNIYITVV 140

  Fly   115 EEPALPGVDEHATVLTQMETSSQ-------AIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVM 172
            :..|.   |::|..:.|::.:.|       .:.:.:||::..|.|.|.||::......|.|..:.
  Fly   141 KYDAW---DKYAKEIEQLQLNMQNFTATVGTVERNINDMMGYQAHSRHRESRDYALLLDNNAYIQ 202

  Fly   173 VWSSLETAAVIVIGLVQIMVLRNFFTDRKPSQA 205
            .:|..:...:::...||:..:|..|..:..|::
  Fly   203 TFSISQIVVILITCSVQVFFVRKLFEVKSSSKS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 44/183 (24%)
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 44/184 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454840
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.