DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and tmed3

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001122140.1 Gene:tmed3 / 336391 ZFINID:ZDB-GENE-030131-8335 Length:206 Species:Danio rerio


Alignment Length:192 Identity:84/192 - (43%)
Similarity:121/192 - (63%) Gaps:0/192 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VALMMHCISAVEFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQGKVIYSLE 74
            :|:.:..::|.|.||:|.||...|||||:::......:|||.|||..|||..:.||...::|...
Zfish     8 LAVYIAFVNATELTFELPDNEKQCFYEELEQGVKFDIDFQVIAGGNYDVDCFVTDPINNMLYQER 72

  Fly    75 KATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYVDFQVGEEPALPGVDEHATVLTQMETSSQAI 139
            |..:||........|||..||.|:||.||||.||:||:.||:..|......||.|||||::..:|
Zfish    73 KKQYDSFSHTTVMKGVYKVCFSNEFSTFSHKTVYLDFRSGEDDRLFPDQNRATALTQMESACLSI 137

  Fly   140 HKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQIMVLRNFFTDRK 201
            |:.|..:.|:||.:||||||.|.|||||::||..||..||..:.|:.:.|:::|::||.::|
Zfish   138 HEILKVVSDSQTWYRLREAQDRLRAEDLHERVHFWSIGETVILFVVCIGQVLMLKSFFNEKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 79/175 (45%)
tmed3NP_001122140.1 EMP24_GP25L 19..196 CDD:279450 80/176 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585526
Domainoid 1 1.000 183 1.000 Domainoid score I3369
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I3790
OMA 1 1.010 - - QHG52485
OrthoDB 1 1.010 - - D528360at33208
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - otm24233
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1789
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.