DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and tmed2

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_021334783.1 Gene:tmed2 / 321550 ZFINID:ZDB-GENE-030131-269 Length:208 Species:Danio rerio


Alignment Length:215 Identity:58/215 - (26%)
Similarity:96/215 - (44%) Gaps:29/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TQIVVFAVALMMHCISAVEFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQG 67
            ::::|...||   ..:|..:...:..:|.:||||.:...:.....|:|:.||.||:||.:..|.|
Zfish     5 SELIVLLCAL---SYTASGYFVSIDAHAEECFYERVNSGTKMSLMFEVAEGGFLDIDVKITGPDG 66

  Fly    68 KVIYSLEKATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYVDFQVGEEPALPGV---------D 123
            |.||..::.:...:...|...|.|..||.|:.|..:.|||.....:||.|....:         |
Zfish    67 KQIYKGDRESSGKYSVAAHMDGTYKFCFSNEMSTMTPKIVMFTIDIGEAPKGQDMETEGGGDSWD 131

  Fly   124 EHATVLTQMETSSQAIHKGLNDILDAQT-------HHRLREAQGRKRAEDLNQRVMVWSSLETAA 181
            .|...|.:|          :|::..|.|       :..:||...|...::.|.||::||..|...
Zfish   132 AHQNKLEEM----------INELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALV 186

  Fly   182 VIVIGLVQIMVLRNFFTDRK 201
            ::.:.|.||..|:.||..|:
Zfish   187 LVAMTLGQIYYLKRFFEVRR 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 51/191 (27%)
tmed2XP_021334783.1 EMP24_GP25L 20..203 CDD:307313 52/192 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.