DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and p24-2

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster


Alignment Length:207 Identity:51/207 - (24%)
Similarity:92/207 - (44%) Gaps:29/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNTQIVVFAVAL-MMHCISAVEFTFDLADNAVDCFYEEIKKNSSAYFEFQV------------SA 52
            |..|.:..|:.| ::|  ||....|.::.....||.||:...::....::|            |:
  Fly     1 MRDQFISLALILCVLH--SACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSS 63

  Fly    53 GGQLDVDVTLKDPQGKVIYSLEKATFDSHQFVAETTGVYTAC-FGNQFSAFS--HKIVYVDFQVG 114
            .| :.:.|.::|...|::.|...::.....|.:.|.|.:..| |.|..:.||  ...|::|.|||
  Fly    64 PG-IGMHVEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQVG 127

  Fly   115 EEPALPGVDEHATV-----LTQMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVW 174
            |...     ::|.|     ||:::...:.:...:..|...|.:.|.||.:.|..:|..|.||:.|
  Fly   128 EHAI-----DYAHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWW 187

  Fly   175 SSLETAAVIVIG 186
            |..:|..::.:|
  Fly   188 SLAQTVVLVCMG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 44/186 (24%)
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 44/186 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454825
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.