DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and Tmed1

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_006242706.1 Gene:Tmed1 / 315461 RGDID:1311679 Length:262 Species:Rattus norvegicus


Alignment Length:227 Identity:62/227 - (27%)
Similarity:90/227 - (39%) Gaps:45/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EFTFDLADNAVDCFYEEIKKNSSAYFEFQ-----------------------------------V 50
            ||||.|......|||:....|:|...|:|                                   |
  Rat    33 EFTFLLPAGRKQCFYQSAPANASLETEYQFDNSRVEVENRLLQVALQSPQALLLYPKQRNGIFVV 97

  Fly    51 SAGGQLDVDVTLKDPQGKVIYSLEKATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYVD----- 110
            ..|..||||.||:.|||.::.|..:.....|.......|.|..||.|.||..|.|:|:.:     
  Rat    98 IGGAGLDVDFTLESPQGVLLVSESRKADGVHTVEPTEAGDYRLCFDNSFSTISEKLVFFELIFDS 162

  Fly   111 FQVGEEPA--LPGVDEHATVLTQME---TSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQR 170
            ||..||..  ...|:....:..:||   .|.:.:...|...:...|..|..||:.|...||..:|
  Rat   163 FQDEEEVEGWAEAVEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEDNLER 227

  Fly   171 VMVWSSLETAAVIVIGLVQIMVLRNFFTDRKP 202
            |..||:...|.::::.::|:..|:.||.|:.|
  Rat   228 VNFWSAANVAVLLLVAVLQVCTLKRFFHDKCP 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 58/220 (26%)
Tmed1XP_006242706.1 EMP24_GP25L 33..254 CDD:279450 58/220 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344434
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.