DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and CHOp24

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster


Alignment Length:200 Identity:54/200 - (27%)
Similarity:102/200 - (51%) Gaps:10/200 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QIVVFAVALMMHCISAVEFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQGK 68
            ::::...:|::.|.::..|...:..:..:||:|.::..:.....|:|..||.||||:.:..|...
  Fly     7 KVLLLVGSLLILCRTSHAFIVSVDAHNEECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPDNH 71

  Fly    69 VIYSLEKATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYVDFQVGE----EPALPGVDE--HAT 127
            |::..||.:...:.|||...|.||.||.|:.|:.:.|:|.....||:    .|..||.:|  |  
  Fly    72 VMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPGAPGEEEVGH-- 134

  Fly   128 VLTQMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQIMV 192
              |::|...:.:...|..:...|.:..:|:...|...|:.|.||::||:.|...::::.:.|:..
  Fly   135 --TKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYY 197

  Fly   193 LRNFF 197
            |:.||
  Fly   198 LKRFF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 50/181 (28%)
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 51/182 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm1213
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.