DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and Tmed5

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001007620.1 Gene:Tmed5 / 289883 RGDID:1359437 Length:229 Species:Rattus norvegicus


Alignment Length:201 Identity:57/201 - (28%)
Similarity:95/201 - (47%) Gaps:24/201 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQGKVIYSLEKATFDSHQFVA 85
            :|||.|.....:|||:.:...:|...|:||..||:||:|..|..|:|:.:. .|:...|....|.
  Rat    35 DFTFTLPAGQKECFYQPMPLKASLEIEYQVLDGGELDIDFHLASPEGRTLV-FEQRKSDGVHTVE 98

  Fly    86 ETTGVYTACFGNQFSAFSHKIVYVDF---QVGEEPALPGVDEHATVLTQMETSSQAIHKGLNDIL 147
            ...|.|..||.|.||..|.|:::.:.   .:|||  :.|.::....:    |::..:...|.|||
  Rat    99 TEDGDYMFCFDNTFSTISEKVIFFELILDNMGEE--VEGQEDWKKYI----TNTDVLEMKLEDIL 157

  Fly   148 DA--------------QTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQIMVLRNFFT 198
            ::              ||..|..||:.|...|....||..||.:....::|:..:|:..|::.|.
  Rat   158 ESINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSVVNLMVMVVVSAIQVYTLKSLFE 222

  Fly   199 DRKPSQ 204
            |::.|:
  Rat   223 DKRKSR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 54/192 (28%)
Tmed5NP_001007620.1 EMP24_GP25L 35..222 CDD:279450 54/193 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.