DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and SPAC17A5.08

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001342850.1 Gene:SPAC17A5.08 / 2542439 PomBaseID:SPAC17A5.08 Length:210 Species:Schizosaccharomyces pombe


Alignment Length:197 Identity:53/197 - (26%)
Similarity:91/197 - (46%) Gaps:7/197 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVVFAVALMMHCISAVEFTFDLADNAVDCFY-EEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQGK 68
            |.:|.:|.:   .||:|.||.|.:....|:| :........:|.:.|.:||..|||..:|.|..|
pombe     9 ITLFLLASL---ASAIELTFKLENQEKQCYYLDSFHTGEKTHFTYAVQSGGSFDVDYMIKAPSQK 70

  Fly    69 VIYSLEKATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYVDFQVGEEPALPGV--DEHATV-LT 130
            .:...:|.......|..|..|.|..||.|..|.|:.|||.::..:..|.:||.:  ||.... ..
pombe    71 TVALGKKRRQADVFFTLEEKGEYEFCFDNHMSTFTDKIVTMEITMENELSLPALTRDEAKDYKKD 135

  Fly   131 QMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQIMVLRN 195
            .|:::...|...|::|...|.:.:.||.:.....:....|:..:|..|:..|:.:..:|:.:::.
pombe   136 SMQSTVLEISTALSEIDRVQNYFKTREHRNYSTVKSTQARIFWFSLAESIMVVALSALQVFIVKT 200

  Fly   196 FF 197
            ||
pombe   201 FF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 46/179 (26%)
SPAC17A5.08NP_001342850.1 EMP24_GP25L 22..203 CDD:307313 48/181 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45644
Inparanoid 1 1.050 81 1.000 Inparanoid score I1851
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - oto101463
orthoMCL 1 0.900 - - OOG6_103696
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.