DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and emp24

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_588020.1 Gene:emp24 / 2539350 PomBaseID:SPCC24B10.17 Length:199 Species:Schizosaccharomyces pombe


Alignment Length:202 Identity:47/202 - (23%)
Similarity:82/202 - (40%) Gaps:25/202 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFAVALMMHCISAV-EFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQGKVI 70
            ||...|..:.||.| .....|..:..:||||.::.|......:|.:.||...|.:::.:|.|:::
pombe     6 VFKAVLCAYFISVVFGHGITLKPHQRECFYENLRNNDQMSVTYQTNVGGDQLVSMSIYNPAGQIM 70

  Fly    71 YSLEKATFDSHQFVAETTGVYTACFGNQ----------FSAFSHKIVYVDFQVGEEPALPGVDEH 125
            :.....:...:.|..:..|.|..||.|.          |:.  |.::|:.            ||.
pombe    71 HQEVPNSMAQYSFTVKNPGKYMYCFYNDALDGESKEVLFNV--HGVIYIS------------DED 121

  Fly   126 ATVLTQMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQI 190
            ......:....:.:|..::.:...|.:...||...|..||..|.||..||.|:|..::.:.:.||
pombe   122 LDANNPLLGKVRQLHDTISKVKHEQEYFVARERIHRNTAESTNDRVKWWSILQTVILVSVCVFQI 186

  Fly   191 MVLRNFF 197
            ..|:..|
pombe   187 FYLKRLF 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 40/185 (22%)
emp24NP_588020.1 EMP24_GP25L 21..194 CDD:279450 41/187 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.