powered by:
Protein Alignment p24-1 and Ticam2
DIOPT Version :9
Sequence 1: | NP_001259465.1 |
Gene: | p24-1 / 32140 |
FlyBaseID: | FBgn0030341 |
Length: | 210 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_036017008.1 |
Gene: | Ticam2 / 225471 |
MGIID: | 3040056 |
Length: | 251 |
Species: | Mus musculus |
Alignment Length: | 42 |
Identity: | 9/42 - (21%) |
Similarity: | 15/42 - (35%) |
Gaps: | 15/42 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 160 GRKRAEDLNQRV--MVWSSLETAAVIVIGLVQIMVLRNFFTD 199
||...::|:..| ..|:.| ::..||..|
Mouse 134 GRLHLQNLDDAVNGSAWTIL-------------LLTENFLRD 162
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167841026 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22811 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.