DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and tmed-4

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_507861.1 Gene:tmed-4 / 180307 WormBaseID:WBGene00013360 Length:211 Species:Caenorhabditis elegans


Alignment Length:215 Identity:50/215 - (23%)
Similarity:89/215 - (41%) Gaps:33/215 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VALMMHCISAVEFTFDLADNAVDCFYEEI---------------KKNSSAYFEFQVSAGGQLDVD 59
            :||:.....|....|.:|:....||.|||               ..|:..|.::.     .:.:.
 Worm     5 IALLSLATYADSLYFHIAETEKKCFIEEIPDETMVTGNYKVQLYDPNTKGYGDYP-----NIGMH 64

  Fly    60 VTLKDPQGKVIYSLEKATFDSHQFVAETTGVYTACFGNQFSAF---SHKIVYVDFQVGEEPALPG 121
            |.:|||:.|||.|..........|.:.|.|.:..|..:..:|:   :...|::|.|.|:.     
 Worm    65 VEVKDPEDKVILSKLYTAEGRFTFTSNTPGEHVICIYSNSTAWFNGAQLRVHLDIQAGDH----- 124

  Fly   122 VDEHATV-----LTQMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAA 181
            ..::|.:     |.:::...:.:...::.|...|.:.|.||.:.|:.:|..|.||..||..:...
 Worm   125 AQDYAQIAQKDKLNELQLRIRQLLDQVDQITKEQNYQRYREERFRQTSESTNSRVFYWSIAQVVV 189

  Fly   182 VIVIGLVQIMVLRNFFTDRK 201
            :.:.|..|:..||.||..:|
 Worm   190 LAITGAWQMRHLRGFFEAKK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 44/198 (22%)
tmed-4NP_507861.1 EMP24_GP25L 16..206 CDD:366467 45/199 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161748
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.