DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and tmed-1

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_502288.1 Gene:tmed-1 / 178145 WormBaseID:WBGene00010670 Length:234 Species:Caenorhabditis elegans


Alignment Length:218 Identity:53/218 - (24%)
Similarity:96/218 - (44%) Gaps:23/218 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NTQIVVFAVALMMHCISAVEFTFDLADNAVDCFYE--EIKKNSSAYFEFQVSAGGQLDVDVTLKD 64
            |...|:..:...:.| ...:||.::......||::  ::.|:.:...::||..||.|:::..:. 
 Worm     6 NIITVILLITPFILC-GEYDFTVEVPAGKFQCFFQPVDLAKHKTLEVDYQVIDGGDLNINFMIL- 68

  Fly    65 PQGKVIYSLEKATFD-SHQFVAETTGVYTACFGNQFSAFSHKIVYVD-FQVGEEPALPGVDEHAT 127
             .|..|...::...| ||:......|.|..||.|.||..|.|:|:.: |.......|...|..|.
 Worm    69 -HGANILKQDQLKVDGSHRIELNQPGDYQVCFDNSFSYQSRKVVFFEIFLFDAHGNLDEADLSAM 132

  Fly   128 VLTQMETSSQ---------AIHK---GLNDILDAQTHHR--LREAQGRKRA-EDLN-QRVMVWSS 176
            ..|..:.|::         ..|:   |:.:.|:...:|:  ||..:.|.|| ...| .||..||.
 Worm   133 ARTDSDLSAKMNELGVTIDEFHRRANGIKNNLNKVEYHQALLRAHEARDRAVMSANFDRVTFWSV 197

  Fly   177 LETAAVIVIGLVQIMVLRNFFTD 199
            :.|..::.:..||:.::|:.|.:
 Worm   198 VHTLVMVGVAGVQVFMIRSLFEE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 49/195 (25%)
tmed-1NP_502288.1 EMP24_GP25L 24..219 CDD:366467 49/196 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.