DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and TMED1

DIOPT Version :10

Sequence 1:NP_572754.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_006849.1 Gene:TMED1 / 11018 HGNCID:17291 Length:227 Species:Homo sapiens


Alignment Length:192 Identity:58/192 - (30%)
Similarity:92/192 - (47%) Gaps:10/192 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQGKVIYSLEKATFDSHQFVA 85
            ||||.|......|||:....|:|...|:||..|..||||.||:.|||.::.|..:.....|....
Human    33 EFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADGVHTVEP 97

  Fly    86 ETTGVYTACFGNQFSAFSHKIVYVDF---QVGEEPALPG----VDEHATVLTQME---TSSQAIH 140
            ...|.|..||.|.||..|.|:|:.:.   .:.::..:.|    |:....:..:||   .|.:.:.
Human    98 TEAGDYKLCFDNSFSTISEKLVFFELIFDSLQDDEEVEGWAEAVEPEEMLDVKMEDIKESIETMR 162

  Fly   141 KGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQIMVLRNFFTDRKP 202
            ..|...:...|..|..||:.|...|...:||..||::..|.::::.::|:..|:.||.|::|
Human   163 TRLERSIQMLTLLRAFEARDRNLQEGNLERVNFWSAVNVAVLLLVAVLQVCTLKRFFQDKRP 224

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_572754.1 EMP24_GP25L 21..197 CDD:426051 54/185 (29%)
TMED1NP_006849.1 EMP24_GP25L 33..220 CDD:426051 55/186 (30%)
COPI vesicle coat-binding. /evidence=ECO:0000255 218..227 4/7 (57%)