DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and TMED2

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001308374.1 Gene:TMED2 / 10959 HGNCID:16996 Length:208 Species:Homo sapiens


Alignment Length:214 Identity:58/214 - (27%)
Similarity:96/214 - (44%) Gaps:29/214 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QIVVFAVALMMHCISAVEFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQGK 68
            :::|...||:. .:|....:.|.  :|.:||:|.:...:.....|:|:.||.||:||.:..|..|
Human     6 ELLVLLAALLA-TVSGYFVSIDA--HAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNK 67

  Fly    69 VIYSLEKATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYVDFQVGEEPALPGV---------DE 124
            .||..::.:...:.|.|...|.|..||.|:.|..:.|||.....:||.|....:         |.
Human    68 GIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEGGGDTWDA 132

  Fly   125 HATVLTQMETSSQAIHKGLNDILDAQT-------HHRLREAQGRKRAEDLNQRVMVWSSLETAAV 182
            |...|.:|          :|::..|.|       :..:||...|...::.|.||::||..|...:
Human   133 HQNKLEEM----------INELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVL 187

  Fly   183 IVIGLVQIMVLRNFFTDRK 201
            :.:.|.||..|:.||..|:
Human   188 VAMTLGQIYYLKRFFEVRR 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 51/191 (27%)
TMED2NP_001308374.1 EMP24_GP25L 23..203 CDD:366467 52/191 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150908
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.