DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and TMED7-TICAM2

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001157940.1 Gene:TMED7-TICAM2 / 100302736 HGNCID:33945 Length:404 Species:Homo sapiens


Alignment Length:162 Identity:85/162 - (52%)
Similarity:106/162 - (65%) Gaps:0/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AVEFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQGKVIYSLEKATFDSHQF 83
            |.|.||:|.|||..||||:|.:.:....||||..||..|||..|:||.|||:|...|..:||..|
Human    34 ASEITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTF 98

  Fly    84 VAETTGVYTACFGNQFSAFSHKIVYVDFQVGEEPALPGVDEHATVLTQMETSSQAIHKGLNDILD 148
            .|...|.|..||.|:||.|:||.||.||||||:|.|...:...:.|||||::..:||:.|..::|
Human    99 TASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVID 163

  Fly   149 AQTHHRLREAQGRKRAEDLNQRVMVWSSLETA 180
            .|||.||||||||.||||||.||..|.|::|:
Human   164 YQTHFRLREAQGRSRAEDLNTRVAYWHSVDTS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 84/160 (53%)
TMED7-TICAM2NP_001157940.1 EMP24_GP25L 36..189 CDD:279450 81/152 (53%)
TIR_2 250..>341 CDD:304906
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150903
Domainoid 1 1.000 185 1.000 Domainoid score I3391
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I3849
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52485
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - otm41555
orthoMCL 1 0.900 - - OOG6_103696
Panther 1 1.100 - - LDO PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 1 1.000 - - X1789
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.