DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB4 and Scr

DIOPT Version :9

Sequence 1:NP_076920.1 Gene:HOXB4 / 3214 HGNCID:5115 Length:251 Species:Homo sapiens
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:181 Identity:78/181 - (43%)
Similarity:89/181 - (49%) Gaps:75/181 - (41%)


- Green bases have known domain annotations that are detailed below.


Human   139 PVVYPWMRKVHV--STVNPNYAGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCL 201
            |.:||||::||:  ||||.|   ||.||.||:|||.|.||||||||:|||||||||:||||||||
  Fly   302 PQIYPWMKRVHLGTSTVNAN---GETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 363

Human   202 SERQIKIWFQNRRMKWKKDHKLPNTKI-------------------------------------- 228
            :|||||||||||||||||:||:.:..|                                      
  Fly   364 TERQIKIWFQNRRMKWKKEHKMASMNIVPYHMGPYGHPYHQFDIHPSQFAHLSAXDAWHFSGTGX 428

Human   229 ------------------RSG--------------GAAGSAGGPPGRPNGG 247
                              .||              |..|.||||....|||
  Fly   429 RLNQLYQEPYQTAAAASAASGYQSQDGGPIGGGSVGVGGGAGGPGSLANGG 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB4NP_076920.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..134
Antp-type hexapeptide 141..146 3/4 (75%)
Homeobox 165..218 CDD:278475 45/52 (87%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..251 14/98 (14%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 46/52 (88%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.