DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28c1 and ERG11

DIOPT Version :9

Sequence 1:NP_001259464.1 Gene:Cyp28c1 / 32138 FlyBaseID:FBgn0030339 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_011871.1 Gene:ERG11 / 856398 SGDID:S000001049 Length:530 Species:Saccharomyces cerevisiae


Alignment Length:262 Identity:65/262 - (24%)
Similarity:113/262 - (43%) Gaps:49/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 VHGLFPNLPRWLRPKVFPRSHDR-----FYGQMISEALRLRRSKHQERNDFINHLLEMQRELD-- 284
            ::.:|||||.....|   |.|.:     .|..:|.|  |.:.:..|:| |.|:.|::.....|  
Yeast   239 INFVFPNLPLEHYRK---RDHAQKAISGTYMSLIKE--RRKNNDIQDR-DLIDSLMKNSTYKDGV 297

  Fly   285 -LSEEDMASHAMTFMFDGLDTTSNSIAHCLLLLGRNPDCQRRLYEELQLVNPGG-----YLPDLD 343
             ::::::|:..:..:..|..|::.:.|..||.|...||.|:.||||...|..||     |    |
Yeast   298 KMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGGKKELTY----D 358

  Fly   344 ALIDLPYLSACFNESLRIYPAGGWASKTCTKEYELRGSHHSEPLKLRPGDHVMVPIYALHNDPDL 408
            .|.::|.|:....|:||::.......:...|:..:..:.:..|    .|.||:|.....|...:.
Yeast   359 LLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHVPNTSYVIP----AGYHVLVSPGYTHLRDEY 419

  Fly   409 YPEPDVFRPERF-------------LDGGLKNCKQQGI---FLGFGNGPRQCVG-----MRLGLA 452
            :|....|...|:             :|.|. ....:|:   :|.||.|..:|:|     .:||:.
Yeast   420 FPNAHQFNIHRWNKDSASSYSVGEEVDYGF-GAISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVL 483

  Fly   453 MA 454
            |:
Yeast   484 MS 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28c1NP_001259464.1 p450 35..487 CDD:299894 65/262 (25%)
ERG11NP_011871.1 CYP51-like 83..521 CDD:410668 65/262 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I1492
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1477
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.