DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28c1 and CYP714A2

DIOPT Version :10

Sequence 1:NP_572752.1 Gene:Cyp28c1 / 32138 FlyBaseID:FBgn0030339 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_197872.1 Gene:CYP714A2 / 832559 AraportID:AT5G24900 Length:525 Species:Arabidopsis thaliana


Alignment Length:79 Identity:19/79 - (24%)
Similarity:37/79 - (46%) Gaps:25/79 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 IRRVGSELSLS------STAPL-LHRTT-------TQLSNPVQHIESN-----HPLSPLDVDVPM 354
            :.|...::|||      |.:|| ||::.       :..|:|...:.|:     .|.||:.|.:|:
plant   260 VSRSIKQISLSPPPAPGSHSPLSLHQSVRHPSLSFSPYSSPPVSVTSSVQKSISPQSPIPVLLPV 324

  Fly   355 GEQVQTVPIKSAAI 368
                  :|::::.|
plant   325 ------IPVQNSRI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28c1NP_572752.1 CYP6-like 67..493 CDD:410679 19/79 (24%)
CYP714A2NP_197872.1 CYP714 87..522 CDD:410733 19/79 (24%)

Return to query results.
Submit another query.