DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28c1 and TBXAS1

DIOPT Version :9

Sequence 1:NP_001259464.1 Gene:Cyp28c1 / 32138 FlyBaseID:FBgn0030339 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001159725.2 Gene:TBXAS1 / 6916 HGNCID:11609 Length:579 Species:Homo sapiens


Alignment Length:592 Identity:127/592 - (21%)
Similarity:232/592 - (39%) Gaps:125/592 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SLLLGIATLLGAIYAFLVSNFGHWRRRGVTEPRALPLFGSFPNMIWPRQHF---TMDMRDIYMHY 65
            ::.|.:| ||..:..:..|.|....:.|:..|:..|..|   |:.:.||.|   .|::|.:|   
Human    17 TVALSVA-LLALLKWYSTSAFSRLEKLGLRHPKPSPFIG---NLTFFRQGFWESQMELRKLY--- 74

  Fly    66 RNTHSYVGCYLLRAPKLLVLEPRLVYEIYVSAFSHFENNDASKMVDIAKDRLVALNPFVLEGEEW 130
               ....|.||.|...:::.||.::.::.|..||:|.|..||.:    :.:.||.:...|..:.|
Human    75 ---GPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGL----EFKSVADSVLFLRDKRW 132

  Fly   131 RHQRAVFSTLLTNGRIRTTHAIM---------------QRV------------------CLDLCQ 162
            ...|....:..:..::.....::               ||:                  .|..|.
Human   133 EEVRGALMSAFSPEKLNELGLLIMQERIKGHMGGQQAPQRIPPTRLSKPSGIYVNLHYATLPFCM 197

  Fly   163 FIAIKSA-------------GGKDLDCIDLGLRFTGESLFDCVLGIQARTFTDNPLPVVRQNHEM 214
            ...|..|             .|...|.......:|.:.:.....|....::.....|.|:.....
Human   198 VPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRF 262

  Fly   215 SAENRGLAIAGAVHGLFPNLPRWLRP--KVFPRSH----DRFYGQMISE--ALRLRRSKHQERND 271
            ..    ..|...:..|..:.|..:.|  ::.|..:    :.|:.::|..  |||.:::..:.|.|
Human   263 FE----FCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRD 323

  Fly   272 FINHLLEMQ--------RELD---------------------------LSEEDMASHAMTFMFDG 301
            |:..:|:.:        ::.|                           |:.:::...|..|:..|
Human   324 FLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAG 388

  Fly   302 LDTTSNSIAHCLLLLGRNPDCQRRLYEELQLVNPGGYLPDLDALID-LPYLSACFNESLRIYPAG 365
            .:..:|:::....||..|||||.:|..|:.:.......|:..:|.: ||||.....|:||:||..
Human   389 YEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPA 453

  Fly   366 GWASKTCTKEYELRGSHHSEPLKLRPGDHVMVPIYALHNDPDLYPEPDVFRPERFLDGGLKNCKQ 430
            ...::...::.|:.|.      ::..|..:.:.:.|||:||:.:|.|:.|.||||    ....:|
Human   454 FRFTREAAQDCEVLGQ------RIPAGAVLEMAVGALHHDPEHWPSPETFNPERF----TAEARQ 508

  Fly   431 QG---IFLGFGNGPRQCVGMRLGLAMAKAALAAIVQRFEVVVSPRTLNGTELDPLIFVGVHKGGI 492
            |.   .:|.||.|||.|:|:||||...|..|..::.:|.....|.|....:|:....:| .|.|:
Human   509 QHRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSALG-PKNGV 572

  Fly   493 WLQFVPR 499
            :::.|.|
Human   573 YIKIVSR 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28c1NP_001259464.1 p450 35..487 CDD:299894 115/547 (21%)
TBXAS1NP_001159725.2 p450 47..576 CDD:306555 118/556 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.