DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28c1 and Cyp6a17

DIOPT Version :9

Sequence 1:NP_001259464.1 Gene:Cyp28c1 / 32138 FlyBaseID:FBgn0030339 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster


Alignment Length:489 Identity:135/489 - (27%)
Similarity:240/489 - (49%) Gaps:37/489 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLGIATLLGAIYAFLV-SNFGHWRRRGVTEPRALPLFGSFPNMIWP-RQHFTMDMRDIYMHYRN 67
            |||.:..::.::..|.. ...|:|:|||:......||||:..:  || ::|.....||.|..|:|
  Fly     2 LLLALIVVILSLLVFAARRRHGYWQRRGIPHDEVHPLFGNIKD--WPNKRHIAEIFRDYYFKYKN 64

  Fly    68 T-HSYVGCYLLRAPKLLVLEPRLVYEIYVSAFSHFEN-----NDASKMVDIAKDRLVALNPFVLE 126
            : :.:.|.:.......:|.:..|:..:.:..|:||||     |:.        |..::...|.:|
  Fly    65 SDYPFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFENRGVFYNEI--------DDPLSATLFSIE 121

  Fly   127 GEEWRHQRAVFSTLLTNGRIRTTHAIMQRVCLDLCQFIAIKSAG--GKDLDCIDLGLRFTGESLF 189
            |::|||.|...:...|:|:::....|:.:|..::.:....|:|.  |:.|:.:||..|:|.:.:.
  Fly   122 GQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRGQVLEVVDLVARYTADVIG 186

  Fly   190 DCVLGIQARTFTDNPLPVVRQNHEMSAENR-GLAIAGAVHGLFPNLPRWLRPKVFPRSHDRFYGQ 253
            :|..|:...:..|.....|........|:| |..:...:.| ||.|.|.||.|:..:..:.||.:
  Fly   187 NCAFGLNCNSLYDPKAEFVSIGKRAITEHRYGNMLDIFLFG-FPKLSRRLRLKLNIQEAEDFYTK 250

  Fly   254 MISEALRLRRSKHQERNDFINHLLEMQR-------ELDLSEEDMASHAMTFMFDGLDTTSNSIAH 311
            ::.|.:..|....::||||::.|:||.:       |..|:..::.:.|..|...|.:|:|.::..
  Fly   251 IVRETIDYRLRTKEKRNDFMDSLIEMYKNEQSGNSEDGLTFNELLAQAFIFFVAGFETSSTTMGF 315

  Fly   312 CLLLLGRNPDCQRRLYEELQLVNPGGYLPDL--DALIDLPYLSACFNESLRIYPAGGWASKTCTK 374
            .|..|.||.|.|.:|.||:..|. |.:..:.  :.:.::.||.....|:||.||.....::....
  Fly   316 ALYELARNQDVQDKLREEIGNVF-GKHNKEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTDT 379

  Fly   375 EYELRGSHHSEPLKLRPGDHVMVPIYALHNDPDLYPEPDVFRPERFLDGGLKNCKQQGIFLGFGN 439
            ::    |.......:..|..|::|...:|.|||:||||::|:||||.|..:. .:....:|.||.
  Fly   380 DF----SPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPERFTDEEIA-ARPSCTWLPFGE 439

  Fly   440 GPRQCVGMRLGLAMAKAALAAIVQRFEVVVSPRT 473
            |||.|:|:|.|:......||.:::.::..|||.|
  Fly   440 GPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPET 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28c1NP_001259464.1 p450 35..487 CDD:299894 126/458 (28%)
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 126/455 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460925
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.