DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28c1 and Cyp6d4

DIOPT Version :9

Sequence 1:NP_001259464.1 Gene:Cyp28c1 / 32138 FlyBaseID:FBgn0030339 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_651082.1 Gene:Cyp6d4 / 42682 FlyBaseID:FBgn0039006 Length:515 Species:Drosophila melanogaster


Alignment Length:537 Identity:135/537 - (25%)
Similarity:247/537 - (45%) Gaps:63/537 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFGSLLLGIATLLGAIYAFLVSNFGHWRRRG--VTEPRALPLFGSFPNMIWPRQHFTMDMR--DI 61
            ||..:||.: |||...:.:|..::.:|.|||  ..:...:| ||.. :.:| ||..:|.:.  |:
  Fly     1 MFSLILLAV-TLLTLAWFYLKRHYEYWERRGFPFEKHSGIP-FGCL-DSVW-RQEKSMGLAIYDV 61

  Fly    62 YMHYRNTHSYVGCYLLRAPKLLVLEPRLVYEIYVSAFSHFENNDASKMVDIAKDRLVALNPFVLE 126
            |:  ::....:|.|||..|.:|:.:..|...:....|:.|  :|....||..:|.|.| |.|.|.
  Fly    62 YV--KSKERVLGIYLLFRPAVLIRDADLARRVLAQDFASF--HDRGVYVDEERDPLSA-NIFSLR 121

  Fly   127 GEEWRHQRAVFSTLLTNGRIR----TTHAIMQRVCLDLCQFIAIKSAGGKDLDCIDLGLRFTGES 187
            |:.||..|.:.|...|:|:::    |:..|..::...|.:  .:...|.|::|...:...:..:.
  Fly   122 GQSWRSMRHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQK--ELPEEGFKEVDIKKVMQNYAIDI 184

  Fly   188 LFDCVLGIQARTFTDNPLPVVRQNHEMS-AENRGLAIAGAVHGLFPNLPRWLRPKVFPRSHDRFY 251
            :...:.|:...:| :||....|:...:: |.||..|:.|.:..|.|::.::|....|........
  Fly   185 IASTIFGLDVNSF-ENPDNKFRKLVSLARANNRFNAMFGMMIFLVPSIAQFLFRIGFKNPVGLAM 248

  Fly   252 GQMISEALRLRRSKHQERNDFINHLLEMQRELDLSEED---------------------MASHAM 295
            .|::.|.:..|......|.|.:..|::::....:.|.|                     :.:.|.
  Fly   249 LQIVKETVEYREKHGIVRKDLLQLLIQLRNTGKIDENDEKSFSIQKTPDGHIKTISLEAITAQAF 313

  Fly   296 TFMFDGLDTTSNSIAHCLLLLGRNPDCQRRLYEELQ--LVNPGGYLPDLDALIDLPYLSACFNES 358
            .|...|.:||.::.|..:..|.:.|:..:||.:|:.  |....|.: ..|:|..:.:|..|..|:
  Fly   314 IFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEVDETLAKNDGKI-TYDSLNKMEFLDLCVQET 377

  Fly   359 LRIYPAGGWASKTCTKEYELRGSHHSEPLKLRPGDHVMVPIYALHNDPDLYPEPDVFRPERFLDG 423
            :|.||.....::.||::|.:..::|..|    .|..|::.:|.:|:|.:.:|:|:.:.||||.:.
  Fly   378 IRKYPGLPILNRECTQDYTVPDTNHVIP----KGTPVVISLYGIHHDAEYFPDPETYDPERFSEE 438

  Fly   424 GLKNCKQQGIFLGFGNGPRQCVGMRLGLAMAKAALAAIVQRFEVVVSPRTLNGTELDPLIFVGVH 488
            . :|..... |:.||.|||.|:..|:|...:|.|:..|:|.|.|.|..|    :|::      ..
  Fly   439 S-RNYNPTA-FMPFGEGPRICIAQRMGRINSKLAIIKILQNFNVEVMSR----SEIE------FE 491

  Fly   489 KGGIWLQFVPRKNVTTK 505
            ..||.|  :|:..|..:
  Fly   492 NSGIAL--IPKHGVRVR 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28c1NP_001259464.1 p450 35..487 CDD:299894 118/481 (25%)
Cyp6d4NP_651082.1 p450 58..500 CDD:278495 114/468 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460851
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.