DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28c1 and Cyp4g1

DIOPT Version :9

Sequence 1:NP_001259464.1 Gene:Cyp28c1 / 32138 FlyBaseID:FBgn0030339 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster


Alignment Length:571 Identity:118/571 - (20%)
Similarity:218/571 - (38%) Gaps:145/571 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IATLLGAIYAFLVSNFGHWRRR--------GVTEPRALPLFGSFPNMIWPRQHFTMDMRD----- 60
            :.||:|.:.|..:  :.:|||.        .:..|..||:.|        :.|....:.:     
  Fly    28 LTTLVGTLVAMAL--YEYWRRNSREYRMVANIPSPPELPILG--------QAHVAAGLSNAEILA 82

  Fly    61 IYMHYRNTH-----SYVGCYLLRAPKLLVLEPRLVYEIYVSAFSHFENNDASKMVDIAKDRLVAL 120
            :.:.|.|.:     :::|..||    :.:..|..: |:.:|...|....:..:.          .
  Fly    83 VGLGYLNKYGETMKAWLGNVLL----VFLTNPSDI-ELILSGHQHLTKAEEYRY----------F 132

  Fly   121 NPF------VLEGEEWRHQRAVFSTLLTNGRIRT--------THAIMQRVCLDLCQFIAIKSAGG 171
            .|:      :..|..|||.|.:.:.......:::        :.|::.|:.|:          .|
  Fly   133 KPWFGDGLLISNGHHWRHHRKMIAPTFHQSILKSFVPTFVDHSKAVVARMGLE----------AG 187

  Fly   172 KDLDCIDLGLRFTGESLFDCVLGIQARTFTDNPLPVVRQNHEMS---------AENRGLAIAGAV 227
            |..|..|...:.|.:.|....:|::       .||...::.|.:         ...|.:.:...:
  Fly   188 KSFDVHDYMSQTTVDILLSTAMGVK-------KLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRL 245

  Fly   228 HGLFPNLPRWLRPKVFPRSHDRFYG---QMISEALRLRRSKHQE--------------------- 268
            ..::....  ||.|     .||...   .|.|:.::.|:...||                     
  Fly   246 DSIYKFTK--LREK-----GDRMMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPASKK 303

  Fly   269 -----------RND--------FINHLLEMQRELDL--SEEDMASHAMTFMFDGLDTTSNSIAHC 312
                       .||        .::.::||.:..|:  :|:|:.....|.||:|.||||...:..
  Fly   304 EGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFA 368

  Fly   313 LLLLGRNPDCQRRLYEELQLVNPGGYLPD---LDALIDLPYLSACFNESLRIYPAGGWASKTCTK 374
            |.::|.:.|.|.:::.|.:.:.....|.|   .|.: ::.||.....|:||:||.....::..  
  Fly   369 LCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTM-EMKYLERVILETLRLYPPVPLIARRL-- 430

  Fly   375 EYELRGSHHSEPLKLRPGDHVMVPIYALHNDPDLYPEPDVFRPERFLDGGLKNCKQQGIFLGFGN 439
            :|:|:.:  |.|..:..|..|:|..|.:|..||:||.|..|.|:.||...:.| :....|:.|..
  Fly   431 DYDLKLA--SGPYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMAN-RHYYSFIPFSA 492

  Fly   440 GPRQCVGMRLGLAMAKAALAAIVQRFEVVVSPRTLNGTELDPLIFVGVHKG 490
            |||.|||.:..:...|..|:.||:.: :|.|..|....:|...|.:.:..|
  Fly   493 GPRSCVGRKYAMLKLKVLLSTIVRNY-IVHSTDTEADFKLQADIILKLENG 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28c1NP_001259464.1 p450 35..487 CDD:299894 110/532 (21%)
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 105/512 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.