DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28c1 and Tbxas1

DIOPT Version :9

Sequence 1:NP_001259464.1 Gene:Cyp28c1 / 32138 FlyBaseID:FBgn0030339 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_035669.3 Gene:Tbxas1 / 21391 MGIID:98497 Length:533 Species:Mus musculus


Alignment Length:550 Identity:129/550 - (23%)
Similarity:237/550 - (43%) Gaps:96/550 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TLLGAIYAFL----VSNFGHWRRRGVTEPRALPLFGSFPNMIWPRQHF---TMDMRDIYMHYRNT 68
            |||.|:.|.|    :|.|....:.|:..|:..|..|   |:::.||.|   .:::|:.|      
Mouse    19 TLLVALLALLKWYSMSAFSRLEKLGIRHPKPSPFVG---NLMFFRQGFWESQLELRERY------ 74

  Fly    69 HSYVGCYLLRAPKLLVLEPRLVYEIYVSAFSHFENNDASKMVDIAKDRLVALNPFVLEGEEWRHQ 133
            ....|.||.|...:::.||.::.::.|..||:|.|..||.:    :.::||.:..:|....|...
Mouse    75 GPLCGYYLGRRMHVVISEPDMIKQVLVENFSNFSNRMASGL----EPKMVADSVLLLRDRRWEEV 135

  Fly   134 RAVFSTLLTNGRIRTTHAIMQRVCLDLCQFIAIKSAGGKDLDCIDLGLRFTGESLFDC------- 191
            |....:..:..::.....::.:.|..|...:. :.|..:|        .|..:..:.|       
Mouse   136 RGALMSSFSPEKLDEMTPLISQACELLVAHLK-RYAASRD--------AFNIQRCYCCYTIDVVA 191

  Fly   192 --VLGIQARTFTDNPLPVVRQNHEMSAENRGLAIAGAVHGLFPNLPRWLRP--KVFPRSH----D 248
              ..|.|..:......|.|:.....|.    ..|...:..|..:.|..:.|  ::.|..:    :
Mouse   192 SVAFGTQVDSQNSPEDPFVQHCRRAST----FCIPRPLLVLILSFPSIMVPLARILPNKNRDELN 252

  Fly   249 RFYGQMISE--ALRLRRSKHQERNDFINHLLEMQREL--------DLSEEDMAS----------- 292
            .|:..:|..  |||.:::..:.|.||:..:|:.|..:        |:..|.::|           
Mouse   253 GFFNTLIRNVIALRDQQAAEERRRDFLQMVLDAQHSMNSVGVEGFDMVPESLSSSECTKEPPQRC 317

  Fly   293 ----------------HAMTFMFDGLDTTSNSIAHCLLLLGRNPDCQRRLYEELQLVNPGGYLPD 341
                            .|..|:..|.:..:|:::....||..:||||.||.:|:.|.......|:
Mouse   318 HPTSTSKPFTVDEIVGQAFLFLIAGHEVITNTLSFITYLLATHPDCQERLLKEVDLFMGKHPAPE 382

  Fly   342 LDALID-LPYLSACFNESLRIYPAGGWASKTCTKEYELRGSHHSEPLKLRPGDHVMVPIYALHND 405
            ..:|.: ||||....:|:||:||.....::...::.|:.|.      ::..|..:.:.:.|||:|
Mouse   383 YHSLQEGLPYLDMVISETLRMYPPAFRFTREAAQDCEVLGQ------RIPAGTVLEIAVGALHHD 441

  Fly   406 PDLYPEPDVFRPERF-LDGGLKNCKQQGIFLGFGNGPRQCVGMRLGLAMAKAALAAIVQRFEVVV 469
            |:.:|.|:.|.|||| .:..|:  ::...:|.||.|||.|:|:||||.:.|..:..::.:|....
Mouse   442 PEHWPNPETFDPERFTAEARLQ--RRPFTYLPFGAGPRSCLGVRLGLLVVKLTILQVLHKFRFEA 504

  Fly   470 SPRTLNGTELDPLIFVGVHKGGIWLQFVPR 499
            ||.|....:|:....:| .|.|::::.|.|
Mouse   505 SPETQVPLQLESKSALG-PKNGVYIKIVSR 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28c1NP_001259464.1 p450 35..487 CDD:299894 115/508 (23%)
Tbxas1NP_035669.3 p450 47..528 CDD:365848 118/515 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.