DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28c1 and cest-32

DIOPT Version :9

Sequence 1:NP_001259464.1 Gene:Cyp28c1 / 32138 FlyBaseID:FBgn0030339 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_504397.1 Gene:cest-32 / 178909 WormBaseID:WBGene00016862 Length:545 Species:Caenorhabditis elegans


Alignment Length:161 Identity:36/161 - (22%)
Similarity:56/161 - (34%) Gaps:56/161 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 LGLRFTGE-------SLFDCVLGIQ-----ARTFTDNPLPVVRQNHEMSAENRGLAIAGAVHGLF 231
            ||...||:       .|:|..|.::     .::|..||..|.         ..|.:..|...||.
 Worm   163 LGFMTTGDEVSRGNYGLWDQTLALKWVQEHIKSFGGNPNIVT---------VCGTSAGGVSAGLL 218

  Fly   232 PNLPRWLRPKVFPRSHDRFY------GQMISE-ALRLRRSKHQERNDFINH----------LLEM 279
                     .:.|.|:..|:      |....| ::|.:..:.:...:|..|          |||.
 Worm   219 ---------ALSPHSNKLFHRFMAMSGSAFCEFSIRTKEQEAEIFRNFAKHHGYEGEDSESLLEW 274

  Fly   280 QRELDLSE-------EDMASHAMTFM--FDG 301
            .:...||:       |..||..:||:  |||
 Worm   275 YKSQPLSKFQETATFEKKASGFLTFIPNFDG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28c1NP_001259464.1 p450 35..487 CDD:299894 36/161 (22%)
cest-32NP_504397.1 COesterase 15..516 CDD:278561 36/161 (22%)
Aes <104..>227 CDD:223730 17/81 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.