DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc70-3 and ankrd45

DIOPT Version :9

Sequence 1:NP_001285139.1 Gene:Hsc70-3 / 32133 FlyBaseID:FBgn0001218 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_001018606.1 Gene:ankrd45 / 553808 ZFINID:ZDB-GENE-050522-311 Length:224 Species:Danio rerio


Alignment Length:75 Identity:19/75 - (25%)
Similarity:42/75 - (56%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   560 ESRNELESYAYSLKNQIGDKDKLGAKLSDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLE 624
            |::..|:::...::..:.|::|:..||:.::||...:......:|:.....|..:.:.:|||.||
Zfish   137 EAKQNLQAFIQEVRAIVADQEKVQGKLNKEDKNICINTCSAKSEWINNTRTATAQVFIEQKKLLE 201

  Fly   625 AIVQPVIAKL 634
            .::.||:.||
Zfish   202 DVLAPVLLKL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc70-3NP_001285139.1 HSPA5-like_NBD 29..403 CDD:212681
PTZ00009 32..643 CDD:240227 19/75 (25%)
ankrd45NP_001018606.1 ANK <42..133 CDD:238125
ANK repeat 46..78 CDD:293786
Ank_2 51..143 CDD:289560 1/5 (20%)
ANK repeat 80..111 CDD:293786
ANK repeat 113..143 CDD:293786 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.