powered by:
Protein Alignment Hsc70-3 and ankrd45
DIOPT Version :9
Sequence 1: | NP_001285139.1 |
Gene: | Hsc70-3 / 32133 |
FlyBaseID: | FBgn0001218 |
Length: | 656 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001018606.1 |
Gene: | ankrd45 / 553808 |
ZFINID: | ZDB-GENE-050522-311 |
Length: | 224 |
Species: | Danio rerio |
Alignment Length: | 75 |
Identity: | 19/75 - (25%) |
Similarity: | 42/75 - (56%) |
Gaps: | 0/75 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 560 ESRNELESYAYSLKNQIGDKDKLGAKLSDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLE 624
|::..|:::...::..:.|::|:..||:.::||...:......:|:.....|..:.:.:|||.||
Zfish 137 EAKQNLQAFIQEVRAIVADQEKVQGKLNKEDKNICINTCSAKSEWINNTRTATAQVFIEQKKLLE 201
Fly 625 AIVQPVIAKL 634
.::.||:.||
Zfish 202 DVLAPVLLKL 211
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0443 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.