DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc70-3 and SLC9C2

DIOPT Version :9

Sequence 1:NP_001285139.1 Gene:Hsc70-3 / 32133 FlyBaseID:FBgn0001218 Length:656 Species:Drosophila melanogaster
Sequence 2:XP_011507728.1 Gene:SLC9C2 / 284525 HGNCID:28664 Length:1129 Species:Homo sapiens


Alignment Length:242 Identity:46/242 - (19%)
Similarity:84/242 - (34%) Gaps:85/242 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 VMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKA--------KRALSGSHQVRIEIESFFEGDDF 318
            :|:|        :|:|:....:..|.:|..:.||        .|.:...|:| |||         
Human   790 LMEH--------EGRDVVIALKTKQAIRNVIAKALKNLTFLCSRGIIDKHEV-IEI--------- 836

  Fly   319 SETLTRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKE 383
            ::.|.: |.:.||  .|...:.|....:.        :|.|:.:.|       :.::.|||..:.
Human   837 NKVLLK-KLKALN--NFPKAIPPPTPDIY--------LHNIIWLEG-------KDVLIDFFKERA 883

  Fly   384 PSRGINPDEAVAYGAAVQAG---VLSGEQDTDAIVLLDVNPLTMGIE-----------------T 428
            .....:..:.:..|..:..|   ::||     ..:|..::| |.|||                 |
Human   884 KLACFDSGDTICKGGEMPQGIYLIISG-----MAILHSLSP-TFGIESNQRCDRGSRDMFTEFCT 942

  Fly   429 VGGVMTKL-------IPRNTVIPTKKSQVFSTASDNQHTVTIQVYEG 468
            .|.::.:|       |....:..|.....|.:..|        :|||
Human   943 TGDIIGELSCLLKREIEYTVICETSLQACFISLED--------LYEG 981

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc70-3NP_001285139.1 HSPA5-like_NBD 29..403 CDD:212681 27/148 (18%)
PTZ00009 32..643 CDD:240227 46/242 (19%)
SLC9C2XP_011507728.1 Na_H_Exchanger 98..380 CDD:294713
Ion_trans 638..>731 CDD:278921
CAP_ED 873..980 CDD:237999 20/120 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.