DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIbeta and CKB2

DIOPT Version :9

Sequence 1:NP_996415.1 Gene:CkIIbeta / 32132 FlyBaseID:FBgn0000259 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_014682.1 Gene:CKB2 / 854204 SGDID:S000005565 Length:258 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:97/214 - (45%)
Similarity:133/214 - (62%) Gaps:12/214 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSEEVS-WVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNP 66
            |||.|. |:..|.|.:|:|:||:||.:||.|:|||..|.:.|..:...:..|:     |:|:|:.
Yeast    31 SSEYVDMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIV-----DDLDDSI 90

  Fly    67 LQS------DMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLS 125
            |::      :..|..:..||||||||||:|.:|:.:|..||:..|||.||||||..|.:||:||.
Yeast    91 LENMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKYKEADFGRCPRVYCNLQQLLPVGLH 155

  Fly   126 DIPGEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLYGF 190
            ||||...||.|||.|.|:|.||||||...|||||||.||.|.....|:..||.||.::||:::||
Yeast   156 DIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPDMVPKHPTKRYVPKIFGF 220

  Fly   191 KIHSLAYQIQLQAAANFKM 209
            ::|..|...:.|.....|:
Yeast   221 ELHKQAQLTRWQELQRLKL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIbetaNP_996415.1 CK_II_beta 8..191 CDD:198153 88/189 (47%)
CKB2NP_014682.1 SKB2 12..258 CDD:227374 97/214 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 193 1.000 Domainoid score I618
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55572
Inparanoid 1 1.050 201 1.000 Inparanoid score I856
Isobase 1 0.950 - 0.772836 Normalized mean entropy S292
OMA 1 1.010 - - QHG53662
OrthoFinder 1 1.000 - - FOG0001997
OrthoInspector 1 1.000 - - otm46863
orthoMCL 1 0.900 - - OOG6_100687
Panther 1 1.100 - - LDO PTHR11740
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R251
SonicParanoid 1 1.000 - - X1673
TreeFam 1 0.960 - -
1514.810

Return to query results.
Submit another query.