DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIbeta and SteXh:CG42398

DIOPT Version :9

Sequence 1:NP_996415.1 Gene:CkIIbeta / 32132 FlyBaseID:FBgn0000259 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001137541.1 Gene:SteXh:CG42398 / 7354447 FlyBaseID:FBgn0259817 Length:172 Species:Drosophila melanogaster


Alignment Length:177 Identity:76/177 - (42%)
Similarity:100/177 - (56%) Gaps:15/177 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSE--EVSWVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELE 63
            ||||:  ..||:.||.|::||||.|.|..||:||.||..||.    .:.:.||:|  |:|..:..
  Fly     1 MSSSQNNNSSWIDWFLGIKGNEFLCRVPTDYVQDTFNQMGLE----YFSEILDVI--LKPVIDSS 59

  Fly    64 DNPLQSDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIP 128
            ...|..|     .:..||:||||||.:.||:..|..||..|||..||.:.|:.|..||:||||:.
  Fly    60 SGLLYGD-----EKKWYGMIHARYIKSERGVIAMHRKYMRGDFESCPNISCDRQNTLPVGLSDVW 119

  Fly   129 GEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYR 175
            |::.||.|||:|...:.|||..  ..|||.||..||.:.|.:.|..|
  Fly   120 GKSTVKIYCPRCKKNFHPKSDT--QLDGAMFGPSFPDIFFSLLPNLR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIbetaNP_996415.1 CK_II_beta 8..191 CDD:198153 72/168 (43%)
SteXh:CG42398NP_001137541.1 CK_II_beta 11..166 CDD:198153 71/167 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448623
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.