DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIbeta and CkIIbeta2

DIOPT Version :9

Sequence 1:NP_996415.1 Gene:CkIIbeta / 32132 FlyBaseID:FBgn0000259 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_477407.1 Gene:CkIIbeta2 / 37300 FlyBaseID:FBgn0026136 Length:219 Species:Drosophila melanogaster


Alignment Length:198 Identity:127/198 - (64%)
Similarity:153/198 - (77%) Gaps:2/198 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSEEVSWVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDN 65
            |:.|:|.||:.|||..|||||||||||:||||||||..|:..|.||:.||::||||.|....|| 
  Fly     1 MTDSDESSWIHWFCKQRGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCALEVILDLNPGSASED- 64

  Fly    66 PLQSDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIPGE 130
            |.:.:: |.:||.||||||||:|||||||..|::||..|:||.|||.:|.|||:||:||||.|||
  Fly    65 PAEPEL-EASAEKLYGLIHARFILTNRGIELMLDKYNKGEFGTCPRAFCHSQPVLPIGLSDNPGE 128

  Fly   131 AMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLYGFKIHSL 195
            .||:.|||||.|||.||:|||.:.|||:||||||||.||..|:.||||...:|||||||||||..
  Fly   129 DMVRIYCPKCNDVYIPKASRHSNLDGAFFGTGFPHMFFMEKPDARPKRAKQKFVPRLYGFKIHPT 193

  Fly   196 AYQ 198
            ||:
  Fly   194 AYR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIbetaNP_996415.1 CK_II_beta 8..191 CDD:198153 118/182 (65%)
CkIIbeta2NP_477407.1 CK_II_beta 9..189 CDD:279546 117/181 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448493
Domainoid 1 1.000 237 1.000 Domainoid score I608
eggNOG 1 0.900 - - E1_COG5041
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 245 1.000 Inparanoid score I1054
Isobase 1 0.950 - 0.772836 Normalized mean entropy S292
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 1 1.000 - - FOG0001997
OrthoInspector 1 1.000 - - mtm1021
orthoMCL 1 0.900 - - OOG6_100687
Panther 1 1.100 - - P PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1673
1211.750

Return to query results.
Submit another query.