DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIbeta and Ste:CG33242

DIOPT Version :9

Sequence 1:NP_996415.1 Gene:CkIIbeta / 32132 FlyBaseID:FBgn0000259 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_996426.2 Gene:Ste:CG33242 / 2768898 FlyBaseID:FBgn0053242 Length:171 Species:Drosophila melanogaster


Alignment Length:158 Identity:63/158 - (39%)
Similarity:84/158 - (53%) Gaps:13/158 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNPLQSDMTEQAAEML 79
            |.|.....|.|..||:||.||..||.    .:.:.||:|  |:|..:.....|..|     .:..
  Fly    16 GSRATSSSCRVPTDYVQDTFNQMGLE----YFSEILDVI--LKPVIDSSSGLLYGD-----EKKW 69

  Fly    80 YGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIPGEAMVKTYCPKCIDVY 144
            ||:||||||.:.||:..|..||..||||.||.:.|:.|..||:|||.:.|::.||.:||:|...:
  Fly    70 YGMIHARYIRSERGLIAMHRKYMRGDFGSCPNISCDRQNTLPVGLSAVWGKSTVKIHCPRCKSNF 134

  Fly   145 TPKSSRHHHTDGAYFGTGFPHMLFMVHP 172
            .|||..  ..|||.||..||.:.|.:.|
  Fly   135 HPKSDT--QLDGAMFGPSFPDIFFSMLP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIbetaNP_996415.1 CK_II_beta 8..191 CDD:198153 63/158 (40%)
Ste:CG33242NP_996426.2 CK_II_beta 24..165 CDD:198153 61/150 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448635
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.772836 Normalized mean entropy S292
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.