DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIbeta and CSNK2B

DIOPT Version :9

Sequence 1:NP_996415.1 Gene:CkIIbeta / 32132 FlyBaseID:FBgn0000259 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001311.3 Gene:CSNK2B / 1460 HGNCID:2460 Length:215 Species:Homo sapiens


Alignment Length:215 Identity:190/215 - (88%)
Similarity:206/215 - (95%) Gaps:0/215 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSEEVSWVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDN 65
            |||||||||::|||||||||||||||||||||||||||||||||:|||||||||||||::|||||
Human     1 MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDN 65

  Fly    66 PLQSDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIPGE 130
            |.|||:.|||||||||||||||||||||||||:||||.||||:|||||||:|||||:||||||||
Human    66 PNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGE 130

  Fly   131 AMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLYGFKIHSL 195
            ||||.|||||:||||||||||||||||||||||||||||||||||||||.|||||||||||||.:
Human   131 AMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPM 195

  Fly   196 AYQIQLQAAANFKMPLRAQR 215
            |||:|||||:|||.|::..|
Human   196 AYQLQLQAASNFKSPVKTIR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIbetaNP_996415.1 CK_II_beta 8..191 CDD:198153 166/182 (91%)
CSNK2BNP_001311.3 CK_II_beta 8..191 CDD:198153 166/182 (91%)
Interaction with alpha subunit. /evidence=ECO:0000250 188..193 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146892
Domainoid 1 1.000 374 1.000 Domainoid score I887
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55572
Inparanoid 1 1.050 416 1.000 Inparanoid score I1824
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 1 1.000 - - FOG0001997
OrthoInspector 1 1.000 - - oto90614
orthoMCL 1 0.900 - - OOG6_100687
Panther 1 1.100 - - LDO PTHR11740
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R251
SonicParanoid 1 1.000 - - X1673
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.