DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and ptgdsb.2

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001038878.1 Gene:ptgdsb.2 / 751701 ZFINID:ZDB-GENE-030911-3 Length:184 Species:Danio rerio


Alignment Length:205 Identity:41/205 - (20%)
Similarity:77/205 - (37%) Gaps:63/205 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTAVLIIILDVLLAPVGANLWTRHNSNAYQTRRRSGPSNRCPKVGAIKNFDLERMMGCWHVVQYY 77
            :|:|::.:|.:||..|.|:                      ..|..:.:|||:::.|.|::|   
Zfish     1 MTSVVVKMLCLLLCAVFAS----------------------ADVMPMTDFDLQKVEGKWYLV--- 40

  Fly    78 ASTEELPEYACMRSHFSFSKEDQHITMNFSYIFAED----------PLREKLVGNITWMIPKFQE 132
                   .:|.....|:..|.|  :.|..:.:...:          |..:.....:|.:..|.:.
Zfish    41 -------GFATNAKWFASKKVD--VKMGTAMLVPTEEGDLELNCYKPKSDGTCWKMTNLAKKTET 96

  Fly   133 PG-------HWQHTEDIYEGIYNTYVLDTDYDTWGLVMHCAEKKKQPRYLSALLLSRKTSLADNE 190
            ||       .|::..|:       .|:|..:|.:. |:|..:.|.....:...||||...:||: 
Zfish    97 PGRFVFYSQRWKNDNDL-------RVVDATFDKYA-VIHVIKTKAGESDVLNKLLSRTPEIADD- 152

  Fly   191 ISFLRGKLPQ 200
               |:.|..|
Zfish   153 ---LKEKFRQ 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KarlNP_001285137.1 None
ptgdsb.2NP_001038878.1 Lipocalin 35..175 CDD:278490 30/149 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D558802at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.