DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and Mup-ps16

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_011248449.1 Gene:Mup-ps16 / 667278 MGIID:3645603 Length:229 Species:Mus musculus


Alignment Length:146 Identity:32/146 - (21%)
Similarity:53/146 - (36%) Gaps:51/146 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RRRSGPSNRCPKVGAIKNFDLERMMGCWHVVQYYAS--TEELPEYACMRSHFSFSKEDQHITMNF 106
            |.|.||.             :..:.|.|:.: ..||  .|::.|:..||...      :||.:  
Mouse    57 RSRCGPR-------------MNEINGEWYTI-ILASDKREKIEEHGSMRLFV------EHIHV-- 99

  Fly   107 SYIFAEDPLREKLVGNITWMIPKFQEPGHWQHTEDIYEGIYNTY-VLDTDYDTWGLVMHCAEKKK 170
                .|:.|..||                  ||.|  :| :||: :|.|:||.: ::.|...:..
Mouse   100 ----LENSLGFKL------------------HTVD--DG-FNTFTILKTEYDNY-IMFHLINEMN 138

  Fly   171 QPRYLSALLLSRKTSL 186
            ...:...||...:..|
Mouse   139 GETFQLMLLYDLEPDL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KarlNP_001285137.1 None
Mup-ps16XP_011248449.1 lipocalin_FABP 66..182 CDD:385686 28/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D558802at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.