DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and ptgdsa

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001186920.1 Gene:ptgdsa / 555483 ZFINID:ZDB-GENE-081022-118 Length:190 Species:Danio rerio


Alignment Length:150 Identity:33/150 - (22%)
Similarity:53/150 - (35%) Gaps:51/150 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KNFDLERMMGCWHVVQYYASTEELPEYACMRSHFSFSKEDQHITMNFSYIFAEDPLREKLVGNIT 124
            |||||:|..|.|:.:   ....:.|.:...||         .:|::...:..:|.      ||:.
Zfish    22 KNFDLQRFAGRWYRI---GLAYDSPGFVPHRS---------KVTISMGTVEPQDN------GNVN 68

  Fly   125 WMIPKFQEPGHWQHTED-------IYE-----GIYNTY-----------VLDTDYDTWGLVMHCA 166
            ..:        |..|..       |||     |::|.|           |::|:|..:.:|:  .
Zfish    69 MTM--------WSLTSSGCKQKIYIYEKTSVSGVFNYYSTRHRRMKDVTVVETNYSEYAMVV--K 123

  Fly   167 EKKKQPRYLSALLLSRKTSL 186
            .||....|....|..|...|
Zfish   124 HKKMNKEYTQVSLYGRAKKL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KarlNP_001285137.1 None
ptgdsaNP_001186920.1 Lipocalin 30..169 CDD:278490 26/141 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D558802at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.