DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and LCN10

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001001712.2 Gene:LCN10 / 414332 HGNCID:20892 Length:200 Species:Homo sapiens


Alignment Length:229 Identity:49/229 - (21%)
Similarity:77/229 - (33%) Gaps:68/229 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RNGSLLLTAVLIIILDVLLAPVGANLWTRHNSNAYQTRRRSG---------------PSNRCPKV 56
            |.|.|:|..||:::| ||.|......|....|:|....:.||               |:....|:
Human     2 RQGLLVLALVLVLVL-VLAAGSQVQEWYPRESHALNWNKFSGFWYILATATDAQGFLPARDKRKL 65

  Fly    57 GA--IKNFDLERMMGCWHVVQYYASTEELPEYACMRSHFSFSKEDQHITMNFSYIFAEDPLREKL 119
            ||  :|    ...:|...|:..:...:     .|........|:.:......:..:|..| ||..
Human    66 GASVVK----VNKVGQLRVLLAFRRLK-----GCQSQEVILRKDGKKPVFGNACAYAAGP-REGQ 120

  Fly   120 VGNITWMIPKFQEPGHWQHTEDIYEGIYNTYVLDTDYDTWGLVMHCAEKKKQPRYLSALLLSRKT 184
            .|                     .:|:...:||.||| ::|||.              |.|.|.|
Human   121 EG---------------------VKGVKAFHVLSTDY-SYGLVY--------------LRLGRAT 149

  Fly   185 SLADNEISFLRGKLPQDIDTSFMFNIGQESCDNL 218
            ....|.:.|.|    |::.:........::||.|
Human   150 QNYKNLLLFHR----QNVSSFQSLKEFMDACDIL 179



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D558802at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.