DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and LCN2

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_005555.2 Gene:LCN2 / 3934 HGNCID:6526 Length:198 Species:Homo sapiens


Alignment Length:189 Identity:42/189 - (22%)
Similarity:73/189 - (38%) Gaps:44/189 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PSNRCPKVGAIKNFDLERMMGCWHVVQYYASTEELPEYACMRSHFSFSKEDQHITMNFSYIFAED 113
            |:....||...:||...:..|.|:||       .|...|.:|       ||:.....::.|:   
Human    29 PAPPLSKVPLQQNFQDNQFQGKWYVV-------GLAGNAILR-------EDKDPQKMYATIY--- 76

  Fly   114 PLREKLVGNITWMIPKFQEPGHWQHT--------------EDIYEGI--YNTYVLDTDYDTWGLV 162
            .|:|....|:|.::.:.::..:|..|              ...|.|:  |...|:.|:|:...:|
Human    77 ELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMV 141

  Fly   163 MHCAEKKKQPR-YLSALLLSR----KTSLADNEISFLRG-KLPQDIDTSFMFNIGQESC 215
            ..  :|..|.| |....|..|    .:.|.:|.|.|.:. .||::   ..:|.:..:.|
Human   142 FF--KKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPEN---HIVFPVPIDQC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KarlNP_001285137.1 None
LCN2NP_005555.2 Lipocalin 49..193 CDD:306552 36/165 (22%)
Carboxymycobactin binding. /evidence=ECO:0007744|PDB:1X89, ECO:0007744|PDB:1X8U 72..74 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D558802at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.