DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and Mup4

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_038966180.1 Gene:Mup4 / 362527 RGDID:735211 Length:229 Species:Rattus norvegicus


Alignment Length:223 Identity:47/223 - (21%)
Similarity:77/223 - (34%) Gaps:77/223 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VLLAPVGANLWTRHNSNAYQTRRRSGPSNRCPKVGAIKNFDLERMMGCW-HVVQYYASTEELPEY 86
            :||..:|..|...|...|...|               .|.|::::.|.| .:|......|::.|.
  Rat     5 LLLLCLGLTLVCGHAEEASSVR---------------GNLDVDKLNGDWFSIVLASDKREKIEEN 54

  Fly    87 ACMRSHFSFSKEDQHI-----TMNFSY-IFAEDPLREKLVGNITWMIPKFQEPGHWQHTEDIYEG 145
            ..||...      |||     ::.|.: |......||  |..:.:..||              :|
  Rat    55 GSMRVFM------QHIDVLENSLGFKFHIKKNGECRE--VYLVAYKTPK--------------DG 97

  Fly   146 IY-------NTY-VLDTDYDTWGLVMHCAEKKKQPRYLSALLLSRKTSLADNEISFLRGKLPQDI 202
            .|       ||: :|.||||.: :::|....|....:...||..|...|:            .||
  Rat    98 EYFVEHDGGNTFTILKTDYDRY-VMIHLVNVKNGETFQLMLLYGRTKDLS------------SDI 149

  Fly   203 DTSFMFNIGQESC-------DNLMESSR 223
            ...|     ::.|       ||:::.::
  Rat   150 KEKF-----EKLCVAHGITRDNIIDLTK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KarlNP_001285137.1 None
Mup4XP_038966180.1 lipocalin_MUP-like 24..173 CDD:381203 41/204 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D558802at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.