DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and APOD

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001638.1 Gene:APOD / 347 HGNCID:612 Length:189 Species:Homo sapiens


Alignment Length:218 Identity:43/218 - (19%)
Similarity:84/218 - (38%) Gaps:47/218 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VLIIILDVLLAPVGANLWTRHNSNAYQTRRRSGPSNRCPKVGAIKNFDLERMMGCWHVVQYYAST 80
            :|:::|..|     |.|:......|:..       .:||.....:|||:.:.:|.|:.::...:|
Human     3 MLLLLLSAL-----AGLFGAAEGQAFHL-------GKCPNPPVQENFDVNKYLGRWYEIEKIPTT 55

  Fly    81 EELPEYACMRSHFSFSKEDQHITMNFSYIFAEDPLRE--------------KLVGNITWMIPKFQ 131
            .|  ...|:::::|..:..:...:| ..:.|:..:.:              ||....:|.:|   
Human    56 FE--NGRCIQANYSLMENGKIKVLN-QELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMP--- 114

  Fly   132 EPGHWQHTEDIYEGIYNTYVLDTDYDTWGLVMHCAEKKKQPRYLSALLLSRKTSLADNEISFLRG 196
            ...:|              :|.|||:.:.||..|....:......|.:|:|..:|....:..|:.
Human   115 SAPYW--------------ILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKN 165

  Fly   197 KL-PQDIDTSFMFNIGQESCDNL 218
            .| ..:||...|....|.:|..|
Human   166 ILTSNNIDVKKMTVTDQVNCPKL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KarlNP_001285137.1 None
APODNP_001638.1 lipocalin_apoD-like 25..182 CDD:381212 34/183 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.