DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and NLaz

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001259867.1 Gene:NLaz / 33324 FlyBaseID:FBgn0053126 Length:245 Species:Drosophila melanogaster


Alignment Length:222 Identity:50/222 - (22%)
Similarity:83/222 - (37%) Gaps:56/222 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LIIILDVLLAPVGANLWTRHNSNAYQTRRRSGPSNRCPKVGAIKNFDLERMMGCWHVVQYYASTE 81
            |::::.|:...|    |..|....:        ..:||.|..:..||.|..||.|:         
  Fly     9 LLLLISVVFGAV----WVAHAQVPF--------PGKCPDVKLLDTFDAEAYMGVWY--------- 52

  Fly    82 ELPEYACMRSHFSFSKEDQHITMNFSYI--------------FAEDPLREKLVGNITWMIPKFQE 132
               |||..  .|:|....:.|..|:|.|              |...|      .|:|.. .|...
  Fly    53 ---EYAAY--PFAFEIGKKCIYANYSLIDNSTVSVVNAAINRFTGQP------SNVTGQ-AKVLG 105

  Fly   133 PGH----WQHTEDIYEGIYNTYVLDTDYDTWGLVMHCAEKKKQPRYLSALLLSRKTSLADNEISF 193
            ||.    :..|:.:.:.  |..||.|||:::.:|..|........:....:|:|:...:...:..
  Fly   106 PGQLAVAFYPTQPLTKA--NYLVLGTDYESYAVVYSCTSVTPLANFKIVWILTRQREPSAEAVDA 168

  Fly   194 LRGKLPQDIDTS--FMFNIGQESCDNL 218
            .| |:.:|.|.|  |:.:..|::|..|
  Fly   169 AR-KILEDNDVSQAFLIDTVQKNCPRL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KarlNP_001285137.1 None
NLazNP_001259867.1 Lipocalin 36..164 CDD:304412 34/150 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.