DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and CG31659

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_722702.1 Gene:CG31659 / 318875 FlyBaseID:FBgn0051659 Length:192 Species:Drosophila melanogaster


Alignment Length:173 Identity:41/173 - (23%)
Similarity:70/173 - (40%) Gaps:21/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CP-KVGAIKNFDLERMMGCWHVVQYYASTEELPEYACMRSHFSFSKEDQHITMNFSYIFAE---- 112
            || .:.|:.:.|::|..|.|:....|... .|....|..:.|...:|::     ||.:..|    
  Fly    27 CPSNMTAVGDLDMDRFKGKWYTHSIYPHL-SLRVEKCQSTDFIEKEENK-----FSVVARELNTQ 85

  Fly   113 ---DPLREKLVGNITWMIPKFQEPGHWQHTEDIYEGIYNTYVLDTDYDTWGLVMHCAEKKKQPRY 174
               ..:|:..:.|:.   |:|........:....||:. .|||||||..:.:...|.:..|...:
  Fly    86 TGTVKMRKADILNVE---PEFGRYVLGTTSTAFPEGVL-MYVLDTDYVNFAIRFMCFDASKIFSF 146

  Fly   175 LSALLLSRKTSLADNEISFLR--GKLPQDIDTSFMFNIGQESC 215
            ..|::.:||...:...|...:  || ...:....|..:.||||
  Fly   147 HWAVIQTRKRLPSTQVIHMAQYFGK-SAGLVIGDMSKVPQESC 188



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.