DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and Mup5

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_038965406.1 Gene:Mup5 / 298107 RGDID:735107 Length:224 Species:Rattus norvegicus


Alignment Length:179 Identity:42/179 - (23%)
Similarity:66/179 - (36%) Gaps:47/179 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VLLAPVGANLWTRHNSNAYQTRRRSGPSNRCPKVGAIKNFDLERMMGCW-HVVQYYASTEELPEY 86
            :||..:|..|...|...|...|               .|.|::::.|.| .:|......|::.|.
  Rat    48 LLLLCLGLTLVCGHEEEASFER---------------GNLDVDKLNGDWFSIVMASDKREKIEEN 97

  Fly    87 ACMRSHFSFSKEDQHI-----TMNFSY-IFAEDPLREKLVGNITWMIPK----FQEPGHWQHTED 141
            ..||...      |||     ::.|.: |......||..:  :.:..||    |.|         
  Rat    98 GSMRVFV------QHIDVLENSLGFKFHIKVNGKCRELYL--VAYKTPKDGKYFVE--------- 145

  Fly   142 IYEGIYNTY-VLDTDYDTWGLVMHCAEKKKQPRYLSALLLSRKTSLADN 189
             |:| .||: :|.||||.: ::.|....|....:....||.|...|:.:
  Rat   146 -YDG-GNTFNILKTDYDRY-VMFHLVNFKDGETFQLMNLLGRTKDLSSD 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KarlNP_001285137.1 None
Mup5XP_038965406.1 lipocalin_MUP-like 69..224 CDD:381203 36/158 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D558802at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.