DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and Lcn9

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001100030.1 Gene:Lcn9 / 296578 RGDID:1306341 Length:179 Species:Rattus norvegicus


Alignment Length:184 Identity:34/184 - (18%)
Similarity:66/184 - (35%) Gaps:53/184 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KNFDLERMMGCWHVVQYYAST----EELPEYACMRSHFSFSKE-----DQHITMNFSYIFAEDPL 115
            ||:::.|:.|.||:|...:..    ||..:......:..|...     |.||.::...:      
  Rat    27 KNYNMARISGVWHLVSMASDNMTYIEEKGDLRLFIRNIQFLNNSNLQFDFHIMIHGECV------ 85

  Fly   116 REKLVGNITWMIPKFQEPGHWQHTEDIYEGIYNTYVLDTDYDTWGLVMHCAEKKKQPRYLSALLL 180
                  .:|.:..|.:..|.:...   |||.....:::||| |...:.|....|...|       
  Rat    86 ------AVTVVCEKTKNSGEFSIA---YEGENKVLLVETDY-TMYAIFHMQNIKNGTR------- 133

  Fly   181 SRKTSLADNEISFLRGKLPQDIDTSF---------MFNIGQESCDNLMESSRDD 225
                    .::..|.|:..| ||.::         ::.:|.:   |:::.:..|
  Rat   134 --------TQVLALYGRFMQ-IDETYQERFENICKLYGLGSQ---NIIDMTNKD 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KarlNP_001285137.1 None
Lcn9NP_001100030.1 Lipocalin 35..175 CDD:278490 30/174 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D558802at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.