DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and Apod

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_038943926.1 Gene:Apod / 25239 RGDID:2137 Length:204 Species:Rattus norvegicus


Alignment Length:226 Identity:49/226 - (21%)
Similarity:84/226 - (37%) Gaps:59/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AVLIIILDVLLAPVGANLWTRHNSNAYQTRRRSGPSNRCPKVGAIKNFDLERMMGCWHVVQYYAS 79
            |.::::|..|     |.|:|       .|..:|....:||.....:|||:::.:|.|:.:     
  Rat    17 ATMLLLLATL-----AGLFT-------TTEGQSFHLGKCPSPPVQENFDVKKYLGRWYEI----- 64

  Fly    80 TEELPEYACMRSHFSFSKEDQHITMNFSYIFAEDPLREKLVGNITWMIPKFQEPGHWQHTEDIYE 144
             |::|        .||.| ...|..|:|       |.|.  |||..:..:.:..|.....|.  |
  Rat    65 -EKIP--------VSFEK-GNCIQANYS-------LMEN--GNIKVLNKELRPDGTLNQVEG--E 108

  Fly   145 GIYNT--------------------YVLDTDYDTWGLVMHCAEKKKQPRYLSALLLSRKTSLADN 189
            ...:.                    ::|.|||:::.||..|.............:|.|...|...
  Rat   109 AKQSNMSEPAKLEVQFFSLMPPAPYWILATDYESYALVYSCTTFFWFFHVDYVWILGRNPYLPPE 173

  Fly   190 EISFLRGKL-PQDIDTSFMFNIGQESCDNLM 219
            .|::|:..| ..|||.:.:....|.:|.:.:
  Rat   174 TITYLKYILTSNDIDIAKITTTDQANCPDFL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KarlNP_001285137.1 None
ApodXP_038943926.1 lipocalin_apoD-like 40..197 CDD:381212 39/182 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10612
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.