DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and Lcn2

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_570097.1 Gene:Lcn2 / 170496 RGDID:69408 Length:198 Species:Rattus norvegicus


Alignment Length:238 Identity:53/238 - (22%)
Similarity:81/238 - (34%) Gaps:72/238 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GSLLLTAVLIIILDVLLAPVGANLWTRHNSNAYQTRRRSGPSNRCPKVGAIK-----NFDLERMM 68
            |.|.|..||:.:|                    |.:.:....|..|....|.     .|..||..
  Rat     4 GVLCLALVLLGVL--------------------QRQAQDSTQNLIPAPPLISVPLQPGFWTERFQ 48

  Fly    69 GCWHVVQYYASTEELPEYACMRSHFSFSKEDQHITMNFSYIFAEDPLREKLVGNITWMIPKFQEP 133
            |.|.||...|:              :..||.|.....:|.|:   .|:|....|:|.::.:.|..
  Rat    49 GRWFVVGLAAN--------------AVQKERQSRFTMYSTIY---ELQEDNSYNVTSILVRGQGC 96

  Fly   134 GHWQHT--------------EDIYEGI--YNTYVLDTDYDTWGLVMHCAEKKKQPRYLSALLLSR 182
            .:|..|              ...|..|  |:..|.|||||.:.:|.. .:..:..:|....|..|
  Rat    97 RYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFF-QKTSENKQYFKVTLYGR 160

  Fly   183 KTSLAD----NEISFLRG---KLPQDIDTSFMFNIGQESC-DN 217
            ...|:|    ..:||.:.   |     |.:.:|::..:.| ||
  Rat   161 TKGLSDELKERFVSFAKSLGLK-----DNNIVFSVPTDQCIDN 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KarlNP_001285137.1 None
Lcn2NP_570097.1 Lipocalin 48..193 CDD:278490 37/167 (22%)
Carboxymycobactin binding. /evidence=ECO:0000250|UniProtKB:P80188 72..74 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D558802at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.