DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and Apod

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001288282.1 Gene:Apod / 11815 MGIID:88056 Length:189 Species:Mus musculus


Alignment Length:181 Identity:34/181 - (18%)
Similarity:70/181 - (38%) Gaps:31/181 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RCPKVGAIKNFDLERMMGCWHVVQYYASTEELPEYACMRSHFSFSKEDQHITMNFSYIFAEDPLR 116
            :||.....:|||:::.:|.|:.::...::.|  :..|:::::|..:......:|..  .:.|...
Mouse    27 KCPSPPVQENFDVKKYLGRWYEIEKIPASFE--KGNCIQANYSLMENGNIEVLNKE--LSPDGTM 87

  Fly   117 EKLVG-----NIT-------WMIPKFQEPGHWQHTEDIYEGIYNTYVLDTDYDTWGLVMHCAEKK 169
            .::.|     |::       ...|......:|              :|.|||:.:.||..|....
Mouse    88 NQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYW--------------ILATDYENYALVYSCTTFF 138

  Fly   170 KQPRYLSALLLSRKTSLADNEISFLRGKLPQD-IDTSFMFNIGQESCDNLM 219
            .........:|.|...|....|::|:..|..: ||...|....|.:|.:.:
Mouse   139 WLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KarlNP_001285137.1 None
ApodNP_001288282.1 Lipocalin 37..182 CDD:304412 29/162 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.