DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and Mup14

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_006537549.1 Gene:Mup14 / 100039116 MGIID:3702005 Length:235 Species:Mus musculus


Alignment Length:168 Identity:38/168 - (22%)
Similarity:69/168 - (41%) Gaps:25/168 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VLLAPVGANLWTRHNSNAYQTRRRSGPSNRCPKVGAIKNFDLERMMGCWHVVQYYASTEELPEYA 87
            :||..:|..|...|...|..|.|               ||::|::.|.||.:...:...|..|  
Mouse     4 LLLLCLGLTLVCVHAEEASSTGR---------------NFNVEKINGEWHTIILASDKREKIE-- 51

  Fly    88 CMRSHFSFSKEDQHITMNFSYIFAEDPLREKLVGNITWMIPKFQEPGHWQHTEDIYEGIYNTYVL 152
             ...:|....|...:..| |.:.....:|::....::.:..|.::.|.:..|   |:| :||:.:
Mouse    52 -DNGNFRLFLEQIRVLEN-SLVLKFHTVRDEECSELSMVADKTEKAGEYSVT---YDG-FNTFTI 110

  Fly   153 -DTDYDTWGLVMHCAEKKKQPRYLSALLLSRKTSLADN 189
             .||||.: |:.|...:|....:....|..|:..|:.:
Mouse   111 PKTDYDNF-LMAHLINEKDGETFQLMGLYGREPDLSSD 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KarlNP_001285137.1 None
Mup14XP_006537549.1 lipocalin_MUP-like 23..172 CDD:381203 32/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D558802at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.